Protein Info for GFF5658 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methylsuccinyl-CoA dehydrogenase, predicted by (Erb et al, 2007)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF02771: Acyl-CoA_dh_N" amino acids 161 to 273 (113 residues), 78.9 bits, see alignment E=8e-26 PF02770: Acyl-CoA_dh_M" amino acids 277 to 385 (109 residues), 54.5 bits, see alignment E=2.1e-18 PF00441: Acyl-CoA_dh_1" amino acids 401 to 549 (149 residues), 119.8 bits, see alignment E=2.3e-38 PF08028: Acyl-CoA_dh_2" amino acids 419 to 536 (118 residues), 42.4 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: K14448, (2S)-methylsuccinyl-CoA dehydrogenase (inferred from 69% identity to adn:Alide_3214)

Predicted SEED Role

"Methylsuccinyl-CoA dehydrogenase, predicted by (Erb et al, 2007)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>GFF5658 Methylsuccinyl-CoA dehydrogenase, predicted by (Erb et al, 2007) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAGVGLQPSVDQARALLARLRPLFEHGVAALAKACAPGGKLDGAKLDEQQVATFEIAWAS
ADLLAAETALARLDGDALQSQLALIFAVDAIAALLPRLEALYIELGLPLAPLQQLGADAD
WAALRGVACGAQALTAAGRALVAASDAVELGSVALQDPVVMAQDAFRRFAADVVSPQAEH
IHRHDETVPESLLQPMRDMGVFGLSIPESHGGTGPDDGEDATMMVVVTEALSEASLAAAG
SLITRPEILSRALISGGTDEQKATWLPRIAAGDPLCAIAITEPDYGSDVASLALKGTRTE
GGWLLNGAKTWCTFAGKAGLLMVVTRTDPDRSAGYRGLSVLLVEKPSYDGHAFDFQQPGG
GRLAGKAIPTIGYRGMHSFDLAFDNFFVPDANVIGGAGGLGKGFYFTMAGMVGGRMQTSA
RACGVMRAALRASMRYTADRKVFGAPLQDYALTLAKLARMAARLAACRTLAYAIAEQLNA
GGGRMEASLVKLLACRSAEMVTREALQLHGGMGYAEESAVSRYFVDARVLSIFEGAEETL
ALKVIGRSLLEDALKP