Protein Info for GFF5655 in Variovorax sp. SCN45

Annotation: Formate dehydrogenase formation protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 158 to 178 (21 residues), see Phobius details TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 14 to 329 (316 residues), 236.8 bits, see alignment E=2.2e-74 PF04216: FdhE_N" amino acids 31 to 189 (159 residues), 112 bits, see alignment E=5.6e-36 PF24859: FdhE_central" amino acids 203 to 240 (38 residues), 71.3 bits, see alignment 8.5e-24 PF24860: FdhE_C" amino acids 241 to 328 (88 residues), 102.5 bits, see alignment E=1.8e-33

Best Hits

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF5655 Formate dehydrogenase formation protein FdhE (Variovorax sp. SCN45)
MSSSTGNPPPIRTTRILDPEQIAMQAGRQMPFLRLPARSLVFFDRQLRLRQLAASHPMRE
YLIFIADLAQAQHQVLQDYAPVALPASDALEAAAKVLKPPMPAFGWTRDPVWLKELRRLL
GLFRARLPEGAARDTLDRVVVADDAWIEQQADRLSRRIMFGLDLAAAPLIAAGLQAYWTQ
LVLQVAEREGENIYGRTDPGNECPCCGSAPTVSITRIGADEAGFRYLHCSLCGTEWHYVR
IKCTHCESTKGIHFESLSPQPGVELPATGVREGAVKAECCDSCGHYLKQIAMEKDPEVEP
VADDLASVTLDLLVSEAGHQRSGHNLMLLFGDPEIPDDGGGG