Protein Info for GFF5652 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 55 to 77 (23 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 220 to 258 (39 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 361 to 385 (25 residues), see Phobius details amino acids 397 to 424 (28 residues), see Phobius details PF06808: DctM" amino acids 9 to 421 (413 residues), 311.3 bits, see alignment E=4.9e-97 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 426 (408 residues), 310.5 bits, see alignment E=7.6e-97

Best Hits

KEGG orthology group: None (inferred from 51% identity to sil:SPO1456)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF5652 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLAACLGFLVAFAFILFQVPIATALAFAGFGGYVLLNGLTPALSMVATVTKDSTLVYSLI
VLPLFVLMGNLVAGAGISGDLFRAAQAFIGKRRGGLAMATVVACGGFGAICGSSVATAAT
MGKVAIPSMRKLGYGDSLSSAAVAAGGTLGILIPPSVIMVVYGVATQTHIGMLFAAGIVP
GLIAIGGYMAAVKWSVWRKPELAPLAEDNEQVNKLALLRALWPVALIFGVVMGGIYGGFF
TSVEASGIGAAAALVFALTHHSLKLKDIYAILVDTARTSAMMFAIVLGAALFGEFVNLTG
VHEGLLQVVKASGLPPFGIILLMIVLYILLGTVLESLSMILLTVPIFFPIILALGYDPVW
FGILVVMVVEIGLITPPIGVNLFVIRSVMPDIPMMTVVRGVIPFIVADVLRILLIAAVPA
LSLWLPNLLFKAAA