Protein Info for GFF565 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: D-alanine--D-alanine ligase (EC 6.3.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR01205: D-alanine--D-alanine ligase" amino acids 10 to 309 (300 residues), 316.9 bits, see alignment E=6.3e-99 PF01820: Dala_Dala_lig_N" amino acids 54 to 92 (39 residues), 43.9 bits, see alignment 6.7e-15 PF02655: ATP-grasp_3" amino acids 101 to 277 (177 residues), 23.9 bits, see alignment E=8.2e-09 PF07478: Dala_Dala_lig_C" amino acids 113 to 306 (194 residues), 180.1 bits, see alignment E=8.2e-57 PF03133: TTL" amino acids 248 to 285 (38 residues), 20.7 bits, see alignment 4.5e-08

Best Hits

Swiss-Prot: 76% identical to DDL_DELAS: D-alanine--D-alanine ligase (ddl) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 76% identity to dac:Daci_1472)

MetaCyc: 51% identical to D-alanine--D-alanine ligase B (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF565 D-alanine--D-alanine ligase (EC 6.3.2.4) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTVDARSLGKVAVLMGGRSAEREVSLMSGKGVLAALQSKGVDAHAFDPAEREMGELKREG
FQRCFIALHGRFGEDGTVQGALELMGIPYTGPGVMASSVAMDKLMTKRIWIAEGLATPAW
RQVHSAEETVAAFKALGSPMIVKPVREGSTIGLTKVTSEAQCAAAYELAAKQDPLVMCEQ
FIAGDEVTCPVLGTGANAKALPVIRIVAPEGNYDYQNKYFTDDTKYLVPCGLPEGEEAAI
QALVLKAYLTLDCRGWSRADVMIDAKTRKPWLLEINTSPGMTGHSLVPMSAKASGLSYED
LCVALLASAALDNAA