Protein Info for GFF5649 in Variovorax sp. SCN45

Annotation: Selenide,water dikinase (EC 2.7.9.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR00476: selenide, water dikinase" amino acids 13 to 322 (310 residues), 425.8 bits, see alignment E=4.8e-132 PF00586: AIRS" amino acids 56 to 163 (108 residues), 101.7 bits, see alignment E=3.4e-33 PF02769: AIRS_C" amino acids 175 to 348 (174 residues), 77.8 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 70% identical to SELD_BURA4: Selenide, water dikinase (selD) from Burkholderia ambifaria (strain MC40-6)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 94% identity to vpe:Varpa_4726)

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF5649 Selenide,water dikinase (EC 2.7.9.3) (Variovorax sp. SCN45)
MNPTLMNPLAPLRLTSFSHGGGCGCKIAPGVLSQILKNHAGGMIPPELMVGIETADDAAV
YKLNDQQALIATTDFFMPIVDDPYEFGRIAATNAISDVYAMGGRPIMALALVAMPINQLP
VEVIADIVRGGQDVCRAAGIPIAGGHTIDSVEPIYGLVAMGLVHPDRVRRNADAKAGDVL
VLGKPLGVGVLSAALKKEQLSGIGYRQLIENTTKLNTPGIALAALDGVHALTDVTGFGLA
GHTLELARGAKLRAVIEWSKVPLLDNVVVMAAEGMVTGASGRNWAGYGADVELAPGLHPT
AQNLLSDPQTSGGLLVSCAPEAVGAVLKIFRDEGFGQAAVIGRVEAGEPSLRVVP