Protein Info for GFF5646 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 12, methionine/phosphonates) / ABC transporter, permease protein (cluster 12, methionine/phosphonates)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 129 to 169 (41 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 278 (162 residues), 56.5 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 94% identity to vpe:Varpa_4729)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF5646 ABC transporter, permease protein (cluster 12, methionine/phosphonates) / ABC transporter, permease protein (cluster 12, methionine/phosphonates) (Variovorax sp. SCN45)
LSTAAPSAVIRRDPQAMRRLAGCLAALVIAWPMLALSEFNPWALFTSGNLAVIGGFLAGF
FPPDGSPAFLALLLKATLETLAMATAGIALALLIGAPLGFVTTRALSVSRIGPGPGRVRA
GIVRQAARWLLMVLRAIPEIVWALLFVRVFGLGPAAGVLALAITYGGMLGKVYAEILEST
DTRPARALLEGGSGRLAALCYGLLPNTAQELASYTVYRWECAVRASVVMGFVGAGGLGQL
MDQSMKMLNGGEASSILLVFLALVLLADLLSNALRRLLA