Protein Info for GFF5636 in Variovorax sp. SCN45

Annotation: Molybdenum ABC transporter, substrate-binding protein ModA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13531: SBP_bac_11" amino acids 24 to 246 (223 residues), 186.1 bits, see alignment E=1.3e-58 PF01547: SBP_bac_1" amino acids 29 to 239 (211 residues), 85.2 bits, see alignment E=1.3e-27 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 29 to 245 (217 residues), 207.9 bits, see alignment E=9.2e-66 PF04069: OpuAC" amino acids 51 to 233 (183 residues), 21.2 bits, see alignment E=2.9e-08

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 88% identity to vpe:Varpa_4737)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF5636 Molybdenum ABC transporter, substrate-binding protein ModA (Variovorax sp. SCN45)
MRPFRLLSLVVALALPLAAAAQQITVSAAASLTDAFKEIGPKFEAAKSGATVRFNFAASG
VLLQQIGQGAPVDVFASADQDTMNRGVEQKVIDTATRKDFVTNSLVLVEPATGAVGVKTL
QDLSGASVKKIAVGKVATVPVGRYTKQVLDGANLWTALEPKFVQADSVRQVLDYVSRGEV
EAGFVYRTDAAVAGDKVKIAFTPTGHTPVTYPIAVVADSKQKALAGDFIAFLSTPAAQEV
LTRYGFGKP