Protein Info for GFF5627 in Variovorax sp. SCN45

Annotation: [4Fe-4S] cluster assembly scaffold protein Mrp (=ApbC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF01883: FeS_assembly_P" amino acids 9 to 76 (68 residues), 73.8 bits, see alignment E=3.8e-24 PF10609: ParA" amino acids 96 to 339 (244 residues), 349.6 bits, see alignment E=3.3e-108 PF13614: AAA_31" amino acids 99 to 139 (41 residues), 35.4 bits, see alignment 3.7e-12 PF09140: MipZ" amino acids 100 to 240 (141 residues), 36.1 bits, see alignment E=1.6e-12 PF01656: CbiA" amino acids 101 to 268 (168 residues), 50.6 bits, see alignment E=6.7e-17

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 92% identity to vpe:Varpa_4743)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>GFF5627 [4Fe-4S] cluster assembly scaffold protein Mrp (=ApbC) (Variovorax sp. SCN45)
MALTPEGLTDALKAVADPNTGKEFVASRSLKNLQVSEGDVSFDIELGYPAKSQHAAIRKA
LVAAAKAVPGVENVSVNIVTKVISHAVQRGVQLMPNVKNIIAVASGKGGVGKSTTAANLA
LALASEGATVGLLDADIYGPSQPMMMGIEGRPDSADGKTMEPMERHGVQVMSIGFLVDQD
QAMIWRGPMATQALEQLLRQTNWKDLDYLIVDMPPGTGDIQLTLSQRVPMTGAVIVTTPQ
DIALLDAKKGIKMFEKVGVPILGIVENMAVHICSNCGHAEHIFGADGGKKMAAEYQMEYL
GALPLDIKIRLQADSGAPTVVSDPEGDVAGIYKAVARRVAVGIAEKAKDFSSKFPTISIS
KNT