Protein Info for GFF5600 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF20434: BD-FAE" amino acids 59 to 162 (104 residues), 63.5 bits, see alignment E=4.3e-21 PF07859: Abhydrolase_3" amino acids 76 to 163 (88 residues), 55.7 bits, see alignment E=1.3e-18 PF12697: Abhydrolase_6" amino acids 76 to 280 (205 residues), 33.6 bits, see alignment E=1.3e-11 PF00135: COesterase" amino acids 126 to 208 (83 residues), 46.5 bits, see alignment E=5.6e-16

Best Hits

KEGG orthology group: None (inferred from 59% identity to vpe:Varpa_1674)

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF5600 putative esterase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKTTASYDADWLEREYNNRARVPEHPVHFERWARDSAAARQGGRALIDVSYGHAAGETLD
IFPAPRQAGKPPAPVLVFIHGGWWRSLDKADHSFIAPPFVQRGACVVVPNYALCPAVTIP
EITLQMVRALAWVYRHIGAHGGDPHRITVVGHSAGGHLAAMMLACDWSLVGDDLPLALVK
NALGMSGLYDLEPVMHTPSVQASLRLSAEQVAKASPARLPAPLVREGRGELTAMVGALES
GEFLRHNRLIQSAWGERVVPVCEELPGLNHFSIVDALADPRQRLHQAVRSLLSV