Protein Info for GFF5596 in Variovorax sp. SCN45

Annotation: Spermidine/putrescine import ABC transporter permease protein PotB (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 77 to 263 (187 residues), 56 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 56% identity to met:M446_4682)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF5596 Spermidine/putrescine import ABC transporter permease protein PotB (TC 3.A.1.11.1) (Variovorax sp. SCN45)
MRLLTLPAIAIVLALMVAPMAMLLRYSLNIYTPTELMVEAFTPRNYVQVFADPYFREVLS
TTLQVAAVTTLIALLVGLPAGYTLARMPRRWKMWLTLATILPLMVGNVVRSAGWLALLGN
SGLFNAVAQWSGLVREPMQLMFNRPAVVGVMVTIVLPLMVMTLASVIEGIPRNVEEAAAN
LGARPFTVFRRVVLPQAMPGVIAGMSLVFILCMNAYATPVLIGGPRFRMMTPEIYQQFVG
LNNWPFGAALAFMLLAVTLAVVLGIGALLQGRRPPRT