Protein Info for GFF5595 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphatidylserine decarboxylase (EC 4.1.1.65)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 208 to 224 (17 residues), see Phobius details TIGR00163: phosphatidylserine decarboxylase" amino acids 64 to 290 (227 residues), 142.1 bits, see alignment E=8.1e-46 PF02666: PS_Dcarbxylase" amino acids 71 to 291 (221 residues), 149.4 bits, see alignment E=5.6e-48

Best Hits

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 61% identity to bja:bll6631)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.65

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF5595 Phosphatidylserine decarboxylase (EC 4.1.1.65) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNLSRQLQRLALNEDINFLLTNRVPRAALTRFMGWFSRIRHPWVRDASMAVWRTFTDIDL
SEAKKSTFDSLHDCFVRELKPGLRPVDPRPEVLASPSDAIVGACGRIGDDPGAQVFQAKG
FPYPLTDLLGPDPRARAMIDTLRGGSYVTLRLTSSMYHRFHAPAALALEHVTYHSGDTWN
VNPIALQRIERLFCKNERAALHARLADGTPLLLVPVAAILVASMRLRAVDVALNAQYRGP
HELPCNAGYGKGDEMGWFEHGSTILVFTPPGFVLCEGVDTGHRIRMGEALLRRVATTG