Protein Info for PS417_02845 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 69 to 87 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 247 to 275 (29 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details PF01032: FecCD" amino acids 17 to 335 (319 residues), 308 bits, see alignment E=3.3e-96

Best Hits

Swiss-Prot: 37% identical to BTUC_VIBVY: Vitamin B12 import system permease protein BtuC (btuC) from Vibrio vulnificus (strain YJ016)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 92% identity to pfs:PFLU0590)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9H9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PS417_02845 ABC transporter permease (Pseudomonas simiae WCS417)
MITRRYALLLAALGAVLLVSCVLSLGFGPARVPVEVVWRIVLYKAFGVGEVNWPAGQEHI
VWLIRVPRMLLGALVGAGLALIGAVLQAVTRNPLADPHLLGVTSGATLGAVIVVLHVGEV
IGLLTLPLAAFIGALLSMLVVLAVASRNGRLESDRLLLCGVAVSFVMMAAANLLLFMGDH
RAASAVMFWMLGGLGLARWELLAVPTATVLLGLGLLLGMARPLNALMAGEQTAVTLGLNA
RNVRLKVFLVASLMTGVLVSISGSIGFVGLMVPHIARRLVGAEHRRLLPVCVLLGSLFLV
WVDVAARTLIAPEDLPIGVATAAIGGLFFIGLMRRR