Protein Info for GFF559 in Sphingobium sp. HT1-2

Annotation: tannase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07519: Tannase" amino acids 84 to 516 (433 residues), 362.7 bits, see alignment E=1.7e-112

Best Hits

KEGG orthology group: K09252, feruloyl esterase [EC: 3.1.1.73] (inferred from 61% identity to ttu:TERTU_1264)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>GFF559 tannase precursor (Sphingobium sp. HT1-2)
LQKISWNKLGLAMAGAVALCFGLAMPANARTSALIKAQTDAQLVSTISCEALGKVDLTQD
QEAPATITGAKLVAASPAANEYCAVTGYVQPQVQFEIRLPTRSWNGRYFQIGCGGFCGFV
NIAGCGDMLARDFVVAADNMGHVGDILKEPLWGSSADARRDYGARGTHVTALVAKRVIAA
FYGKAPAYRYFRGCSTGGREGLMEAQHHPEDFDGIVSGDPAFAGRLGAIANVWAAQKLFR
RGNVPIFDQASLTLLHQRTIAACDAIDGVKDGIIDDPRQCRFDPASLQCPATGGSDCLTA
EQVAAAKAVYDGPRNSKGQRLYPGGMMPGSEGAWGGADTWSLPQGSLRYLMFAQNPARDY
DYHDFNWDHDLAKVRDQVALYDPVAPGSAPDLAAFHARGGRLILYHGWSDQGVSPLGSLD
YYAQVAARQGGVTSLRDWFRLFMVPGMFHCRGGNAPNSFDFMPGIIAWVEKGAAPDGVVA
SQKDGDTLVRTRPLFAYPAVARYDGKGDVNTAASWHAAMPASTPDGRIDWLWGPAAK