Protein Info for GFF5586 in Variovorax sp. SCN45

Annotation: Acetoin dehydrogenase E1 component beta-subunit (EC 2.3.1.190)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02779: Transket_pyr
  • amino acids 7 to 179 (173 residues), 132.1 bits, E=1.8e-42
• PF02780: Transketolase_C
  • amino acids 195 to 307 (113 residues), 101.6 bits, E=3e-33

Best Hits

Swiss-Prot: 50% identical to ODBB_THET8: 2-oxoisovalerate dehydrogenase subunit beta (TTHA0230) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 93% identity to vpe:Varpa_5742)

MetaCyc: 41% identical to 2-keto-isovalerate dehydrogenase component beta subunit (Bacillus subtilis)
2-oxoisovalerate dehydrogenase (acylating). [EC: 1.2.1.25, 1.2.4.4]

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (24/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• L-leucine degradation I (5/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (25/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• L-isoleucine degradation I (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• L-threonine degradation V (1/2 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• L-valine degradation I (5/8 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1, 1.2.4.4

Use Curated BLAST to search for 1.2.1.25 or 1.2.4.1 or 1.2.4.4

Protein Sequence (322 amino acids)

>GFF5586 Acetoin dehydrogenase E1 component beta-subunit (EC 2.3.1.190) (Variovorax sp. SCN45)
MALTKQELSYSEAALLALQREMEADPRVVVLGEDVGRGGIFGQYKGLQLRFGAERVIDTP
ISEAAIMGAGVGMALAGLRPVVEMRVVDFALCGMDELVNQAAKNRFMFGGQGRVPLVARM
PGGIWDASAAQHSQSLEAWFAHLPGVVVVSPSTPQDNHGLLRAALQCGDPVVYIEHKTLW
GVRGEVDENLEVPLGKAARVREGHALTLVSWSRQMQACVAACDALAAEGIAVDLIDLRTL
WPWDRETVLSSCARTGRLLVVHEAVQAAGFGAEIAASAAEATGCRVARLGAPRIPVGYAP
VLEAQSRVGVPAIVAAAKKLAG