Protein Info for GFF5584 in Variovorax sp. SCN45

Annotation: Cyclic-di-GMP-binding biofilm dispersal mediator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF23441: SDR" amino acids 51 to 245 (195 residues), 29.8 bits, see alignment E=9.8e-11 PF00106: adh_short" amino acids 54 to 244 (191 residues), 189.7 bits, see alignment E=1e-59 PF08659: KR" amino acids 57 to 217 (161 residues), 39.1 bits, see alignment E=1.9e-13 PF01370: Epimerase" amino acids 57 to 228 (172 residues), 23.3 bits, see alignment E=1e-08 PF13561: adh_short_C2" amino acids 63 to 292 (230 residues), 193.9 bits, see alignment E=8.2e-61

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 79% identity to vpe:Varpa_5743)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF5584 Cyclic-di-GMP-binding biofilm dispersal mediator protein (Variovorax sp. SCN45)
MPIFNFQLNLIDPIDGYRERNEMPRLEAFNTQRIGKIMASSNASSSSAPVLAGKVAFVTG
GSRGIGAAIVRRLARDGAAVAFSYASSAAPADELVRAVQAEGGRAFALKIDSADADALKA
GIDQAAKHFGGRIDILVNNAGVLHLGPVEQFPLADFDRTIAVNVRAVFVAIQAALAHMGT
GGRIVNIGSTNAERMPFAGGSVYAMSKSALTGLVQGLARDLGPRGITVNNVQPGPVDTDM
NPASGPMAATMHGFMAIDRHGHADEIAGMVAYLAGPEAAFVTGAGLNIDGGFAA