Protein Info for GFF5581 in Variovorax sp. SCN45

Annotation: SSU ribosomal protein S5p (S2e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF08895: DUF1840" amino acids 1 to 105 (105 residues), 102.9 bits, see alignment E=5.7e-34

Best Hits

KEGG orthology group: None (inferred from 87% identity to vap:Vapar_5036)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF5581 SSU ribosomal protein S5p (S2e) (Variovorax sp. SCN45)
MLYRFQSRASADFVMLEVHARQLLDIVGKSVAPQGIITVEQIPGAISALEAALAREGGNA
HNHDDYAVEGHANDAEKQHVGLHQRAAPLLHMLKDSLADKKDVTWKT