Protein Info for GFF5580 in Variovorax sp. SCN45

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF25371: DUF7884" amino acids 20 to 81 (62 residues), 27.9 bits, see alignment E=8.9e-10 PF02353: CMAS" amino acids 112 to 396 (285 residues), 314.1 bits, see alignment E=3.3e-97 PF13489: Methyltransf_23" amino acids 163 to 275 (113 residues), 45.2 bits, see alignment E=3.6e-15 PF07021: MetW" amino acids 164 to 232 (69 residues), 23.1 bits, see alignment E=2e-08 PF13847: Methyltransf_31" amino acids 172 to 275 (104 residues), 34.3 bits, see alignment E=7.7e-12 PF13649: Methyltransf_25" amino acids 177 to 272 (96 residues), 58.3 bits, see alignment E=4.2e-19 PF08242: Methyltransf_12" amino acids 177 to 273 (97 residues), 45.5 bits, see alignment E=4.3e-15 PF08241: Methyltransf_11" amino acids 177 to 274 (98 residues), 44.6 bits, see alignment E=7.6e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 95% identity to vpe:Varpa_5747)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>GFF5580 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) (Variovorax sp. SCN45)
MGPMQNLIPKIESQLASLPVPIALELPDGRRVAQAGARVTLAFKEWAVLAKLAARQVGAI
GEAYVEGKVQIEGAMRDLIDATVGMLPGNPAETDTGWWSRLQHMAKSHGSHSLRKDAAQI
EFHYDVSDDFYALWLDPRRVYSCAYFRTPDLTLAQAQEAKLDHICRKLMLQPGERYLDIG
SGWGALLLWAAEHYGVDATGITLSKNQHAHVQRLIEEKGLQGRVRVELRDYRELSVDQPF
DKISSVGMFEHVGAANMPTYFRKIHSLLKPGGLVMNHGITSGELNYRQLGAGMGDFIEKY
IFPGGELLHVTHVLRETAAAGLEMVDTESLRPHYARTLWAWSDALEAQLDTARDVLRRSG
GRQGGENAERVLRAYRLYLAGSAMSFEQGWISLHQMLSTRPDGKVEHGVLRGAQSVYPFA
RDYIYK