Protein Info for GFF5579 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF00892: EamA" amino acids 3 to 103 (101 residues), 31.9 bits, see alignment E=7.6e-12 amino acids 150 to 276 (127 residues), 29.7 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: None (inferred from 60% identity to pol:Bpro_1743)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF5579 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQALWMLLASVFFASMGVCIKFASSHFNSFEIVFYRGVVGSVFLIAMTRVNGVSLRTRMP
MMHVWRSIVGTISLTAWFFAIAALPLATAMTLNYMSSVWIATFLLGGALLMQGRNAPIRE
QAPLFLTVLMGFGGVAMMLRPTLAEHQVVGALVGLLSGIFAAFAYLQVAALSRAGEPESR
TVFYFSIGAVLAGGVGMLFSGVSAWHWPSALWLLPIGLLALFGQLCMTRAYSRGATMVVA
NLQYSGIVIAGIYGIVFFNDQLPLLGWLGMALIIVSGITATVLRARAVPNAPAEDH