Protein Info for PS417_28530 in Pseudomonas simiae WCS417

Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF16220: DUF4880" amino acids 10 to 52 (43 residues), 44.3 bits, see alignment 1.3e-15 PF04773: FecR" amino acids 106 to 198 (93 residues), 72.9 bits, see alignment E=2.5e-24

Best Hits

Swiss-Prot: 44% identical to FECR_ECOLI: Protein FecR (fecR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU6131)

Predicted SEED Role

"Fe2+-dicitrate sensor, membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TPX6 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PS417_28530 iron transporter (Pseudomonas simiae WCS417)
MANPDRKTFEAAATWYVQFQSQVPTAAERLAWQQWLNGDPSHQAAWNQMEQLQRSLGALP
QDFTRRALSTTQQRRQVLKWMLVLGGTGYLGWNLQQHTPLGNVWADYRTSVGERRRIELA
DGTRIDLNTRTAIDVVFDGRQRLVRLREGEVLIHTGKLGGQTPFYVETRQGRVQALGTTF
TVRQLPDATRVGVLEDRVSVSPGDQPNHARLLGAGESADFDRQNVGLDRVYSGSQAAWVD
GQLIVLDARLGDVIEDLARYRPGVLQCDLASARLRVSGTFRLDSTDAVLANLQATLPIQV
KYFTRYWVSVKRIG