Protein Info for GFF5573 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 105 to 135 (31 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 334 to 350 (17 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 435 to 435 (1 residues), see Phobius details amino acids 447 to 473 (27 residues), see Phobius details amino acids 503 to 525 (23 residues), see Phobius details PF06808: DctM" amino acids 14 to 523 (510 residues), 303.7 bits, see alignment E=9.9e-95

Best Hits

KEGG orthology group: None (inferred from 78% identity to vpe:Varpa_1728)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (613 amino acids)

>GFF5573 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEFIAANFAPIMFAGLIIFLLLGFPVAFSLGACGLAFGVVGIEMGVFPSSVLAWLPQRLI
GIMANDTLLAVPFFTLMGLILERSGMAEDLLDTVGQVFGPMRGGLALAVVFVGAMLAATT
GVVAASVISMGLISLPIMLRYGYDRQFSSGVIAASGTLAQIIPPSLVLIIMADQLGRSVG
DMYKGAFIPAFMLVGCYVLYIACLAIFKPASVPALPTEARIYREPDGSGGYQSLLVLMVI
SFMVSIVLARYMPEVHTWWLGHEVTSVPTDEKVVVAMAGGAFVALVMALANKYAKLGLLS
RLAERVTFVLIPPLLLIFLVLGTIFLGIATPTEGGAMGAMGAIIMALVRKRLDMKLLKQA
LATTTKLGSFVMFILIGATIFGLVFQAADGPIWVEHLLADLPGGAVGFLIVVNILIFFLA
FFLDYFELSFIVVPLLAPVADKLGIDLIWFGVLLAVNMQTSFMHPPFGFALFFLRSVAPD
KPYVDRVTNKVMAPVTTMQIYKGAIPFLIIQLFMVGVLIAFPGLVTGSLDKVGDYDLKAV
GEQMRENLAPDSEGGGYGGGGGYGADEQAAPPEEGSKEPPATKPEAAGEASPDAKAAAED
DPMKAMQEALGRK