Protein Info for GFF5569 in Variovorax sp. SCN45

Annotation: SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01017: ribosomal protein uS4
  • amino acids 3 to 207 (205 residues), 273.7 bits, E=4.4e-86
• PF00163: Ribosomal_S4
  • amino acids 3 to 96 (94 residues), 101.3 bits, E=4.1e-33
• PF01479: S4
  • amino acids 98 to 144 (47 residues), 73.2 bits, 1.1e-24

Best Hits

Swiss-Prot: 98% identical to RS4_VARPS: 30S ribosomal protein S4 (rpsD) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 98% identity to vpe:Varpa_5758)

MetaCyc: 66% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Protein Sequence (207 amino acids)

>GFF5569 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent (Variovorax sp. SCN45)
VARYLGPKAKLSRREGTDLFLKSARRSIQDKAKFDSKPGQHGRTSGQRTSDYGLQLREKQ
KVKRMYGVLEKQFRRYFEEADRRRGNTGANLLFILESRLDNVVYRMGFGSTRAEARQLVS
HKAITVNGQSVNIPSYLVKTGDVIAVRDKSKKQNRIVEALQLAQQVGIPAWVDVNADKAE
GTFKKVPDRDEFAADINESLIVELYSR