Protein Info for PS417_28495 in Pseudomonas simiae WCS417

Annotation: ATP synthase F0F1 subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 41 to 283 (243 residues), 144.3 bits, see alignment E=2.7e-46 PF00119: ATP-synt_A" amino acids 51 to 282 (232 residues), 193.1 bits, see alignment E=3.1e-61

Best Hits

Swiss-Prot: 97% identical to ATP6_PSEFS: ATP synthase subunit a (atpB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 97% identity to pfs:PFLU6124)

Predicted SEED Role

"ATP synthase F0 sector subunit a"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UK16 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PS417_28495 ATP synthase F0F1 subunit A (Pseudomonas simiae WCS417)
MAETTASGYIQHHLQNLTFGQLPNGGWGFAHSAAEAKEMGFWAFHLDTLGWSVALGLIFV
FIFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA
VDLIPVDWIPQLAMAISGDPHIPFRAVSTTDPNATLGMALSVFALIIFYSIKIKGIGGFI
GELTLHPFGSKNIFVQALLIPVNFLLEFVTLVAKPISLALRLFGNMYAGELVFILIAVMF
GSGLLWLSGLGIVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH