Protein Info for PS417_28465 in Pseudomonas simiae WCS417

Annotation: ATP synthase F0F1 subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR01039: ATP synthase F1, beta subunit" amino acids 3 to 458 (456 residues), 845.4 bits, see alignment E=5.7e-259 PF02874: ATP-synt_ab_N" amino acids 6 to 71 (66 residues), 68.1 bits, see alignment E=1.2e-22 PF00006: ATP-synt_ab" amino acids 128 to 340 (213 residues), 241.7 bits, see alignment E=1e-75 PF22919: ATP-synt_VA_C" amino acids 345 to 423 (79 residues), 54.7 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 99% identical to ATPB_PSEFS: ATP synthase subunit beta (atpD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 99% identity to pfs:PFLU6118)

MetaCyc: 84% identical to ATP synthase F1 complex subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U676 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PS417_28465 ATP synthase F0F1 subunit beta (Pseudomonas simiae WCS417)
MSSGRIVQIIGAVIDVEFPRDSVPSIYNALKVQGADTTLEVQQQLGDGVVRTIAMGSTEG
LKRGLDVVDSGAAISVPVGKATLGRIMDVLGNPIDEAGPIDTEERWGIHRPAPSFAEQAG
GNDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGE
RTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEKFRDEGNDVLLFV
DNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKEGSITSIQAVYVPAD
DLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPNVIGQEHYDTARGVQ
YVLQRYKELKDIIAILGMDELSEADKQLVNRARKIQRFLSQPFFVAEVFTGASGKYVSLK
DTIAGFKGILNGDYDHLPEQAFYMVGGIEEAIEKAKKL