Protein Info for GFF5559 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Topoisomerase IV subunit A (EC 5.99.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 782 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 19 to 776 (758 residues), 724.3 bits, see alignment E=7.2e-222 PF00521: DNA_topoisoIV" amino acids 38 to 503 (466 residues), 434 bits, see alignment E=6.3e-134 PF03989: DNA_gyraseA_C" amino acids 576 to 605 (30 residues), 9.8 bits, see alignment (E = 5.8e-05) amino acids 685 to 728 (44 residues), 21.5 bits, see alignment 1.2e-08

Best Hits

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 86% identity to ajs:Ajs_1016)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (782 amino acids)

>GFF5559 Topoisomerase IV subunit A (EC 5.99.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDSTTEDLPLSSPEPEDNLANYAQRAYLEYALSVVKGRALPDVCDGQKPVQRRILYSMDR
MGLGFSGPNRNTAARPVKSARVVGDVLGRFHPHGDQAAYDALVRMAQDFAQRYPLIDGQG
NFGSRDGDGAAAMRYTEARLSRITTLLLDEIDEGTVDFVPNYDGSTVEPKQLPARLPFNL
LNGASGIAVGLATEIPSHNLREVADACVALVKNPKLADDELLTLLPGPDYPGGGQIISPA
SDIADAYRTGRGSLKVRARWKIEDLARGQWQLVVTELPPGVSTQRVLEEIEELTNPKVKA
GKKALTQEQTQLKASILMVLDGVRDESSKDAPVRLLFEPKSSRIEQQELITALLAHTSLE
TSAPINLTMVGLDGRPTQKSLRQMLTEWIEFRQGTITRRSQHRLTKVLDRIHILEGRQLV
LLNIDEVIRIIRHSDEPKAALIERFKLSDRQAEDILEIRLRQLARLEAIKIEQELKELRE
EQGKLEDILGNPGSLKRLMVKEIEADAKTFADERRTLIQAEKKAVAEIKVVDEPVTVVIS
SKGWVRARTGHGHEAGSFAFKAGDGLYGTFECRTVDTLITFGSNGRVYSVPVASLPGARG
DGQPITTLIELESGTQPLHYFAGPANAALLLSSSGGYGFLATVENMVSRQRGGKTFLNLG
EGETPCAPSHAAFTSGGVPLVPATHVCCASTGGRILTFEIGELKLMEKGGRGLMLIDLEA
KDTLAGAAAYTRSVKIEGIGRGGKEREETLEIRSLNNARAARARKGKAADLGFKPNRITR
VE