Protein Info for PS417_28395 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 PF12146: Hydrolase_4" amino acids 30 to 265 (236 residues), 246.6 bits, see alignment E=4.5e-77 PF12697: Abhydrolase_6" amino acids 35 to 254 (220 residues), 37.2 bits, see alignment E=1e-12 PF00561: Abhydrolase_1" amino acids 35 to 152 (118 residues), 44.5 bits, see alignment E=3.2e-15 PF12147: Methyltransf_20" amino acids 274 to 581 (308 residues), 509.1 bits, see alignment E=8.1e-157

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU6106)

Predicted SEED Role

"Putative lipase in cluster with Phosphatidate cytidylyltransferase" in subsystem Triacylglycerol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJZ0 at UniProt or InterPro

Protein Sequence (582 amino acids)

>PS417_28395 hypothetical protein (Pseudomonas simiae WCS417)
MREQQQHTFSTHDGVELFYRHWPATQSDGPRQAIVLFHRGHEHSGRIAHLVDELNLPHFD
FFAWDARGHGQSPGERGDSPSFATSARDVQTFCDHIGATYGIEEENFAVIAQSVGAVIAA
TWVHDYAPKIRALVLASPAFKVKLYVPFARPGLALMRKFRGNFFVNSYVKAKFLSHDPER
VASYDSDPLITKAISVNVLLGLYEAADRVVADAQAIQVPTQLLISGSDFVVHRKPQQQFF
DRLGSLKKELHILPGFFHDTLGERDRATAVNSARRFILQNFEHPLDRASLLDADKLGATC
AESEALAAALPRNSLRDLYWRMTRASMGLGKSLSDGVKLGFDTGFDSGSTLDYVYRNTPT
GKGGLGRMIDTNYLNSIGWRGIRQRKLNVEELLRLAMAKLRGEGREIRIVDIAAGHGRYI
LEALQGVSPLPESILLRDYSDINVRDGGALIREKGLGDIAQFVKGDAFDRLDLAALEPKP
TLAVVSGLYELFADNGMVGNSLAGLAEAVEPGGYLVYTGQPWHPQLELIARALTSHRQGQ
AWVMRRRSQAEMDQLVEAAGFRKIAQRVDEWGIFTVSLAQKI