Protein Info for GFF5545 in Variovorax sp. SCN45

Annotation: Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF01470: Peptidase_C15" amino acids 12 to 213 (202 residues), 240.2 bits, see alignment E=1.2e-75 TIGR00504: pyroglutamyl-peptidase I" amino acids 12 to 227 (216 residues), 264 bits, see alignment E=6e-83

Best Hits

Swiss-Prot: 64% identical to PCP_CUPTR: Pyrrolidone-carboxylate peptidase (pcp) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K01304, pyroglutamyl-peptidase [EC: 3.4.19.3] (inferred from 86% identity to vpe:Varpa_0698)

Predicted SEED Role

"Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)" in subsystem ZZ gjo need homes (EC 3.4.19.3)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>GFF5545 Pyrrolidone-carboxylate peptidase (EC 3.4.19.3) (Variovorax sp. SCN45)
MKKTTGTASAPRVLLAGFEPFENDPVNPAWEIARALDDWACEGAVAQAVQLPCVFGRAID
RLDEALLAGAPPVLVLCIGAAGGRTEISLERAALNVDDARIPDNAGYQPIDIPVVEGGPA
AYFSTLPIKAMVRDMRAAGLPAAVSNSAGTFVCNHIFYALMHRIATQPALAGTRGGFVHV
PYLPEQAASKPGIASMALATQVEAFRVAIRTALSVHDDVRETGGRLH