Protein Info for GFF5539 in Variovorax sp. SCN45

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 203 (189 residues), 108 bits, see alignment E=2.3e-35

Best Hits

Swiss-Prot: 32% identical to RHTB_ECOL6: Homoserine/homoserine lactone efflux protein (rhtB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_5785)

MetaCyc: 32% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>GFF5539 Transporter, LysE family (Variovorax sp. SCN45)
MTLSAYLLFLPACFAINMAFGPNNLLSVTNGAKHGVSPAVIAASGRLVAFAIMIAIAGLG
MGAVLVASEMAFDVIKYIGAAYLVWIGIRLLRAPAPTAEVQARDASAPPSMRALARQEFT
VAAGNPKAILVFTAFFPQFVVPGAYASSYLLLGVTFLVFELVAIALYALLGARMRRMANG
SRAMRWFNRISGSMMVGFGLILAFTRRPAG