Protein Info for GFF5537 in Variovorax sp. SCN45

Annotation: Cell division inhibitor SulA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details PF01370: Epimerase" amino acids 192 to 405 (214 residues), 83.5 bits, see alignment E=2.4e-27 TIGR01777: TIGR01777 family protein" amino acids 192 to 491 (300 residues), 292.4 bits, see alignment E=2.2e-91 PF08338: DUF1731" amino acids 448 to 494 (47 residues), 66 bits, see alignment 2.9e-22

Best Hits

KEGG orthology group: K07071, (no description) (inferred from 90% identity to vpe:Varpa_5787)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>GFF5537 Cell division inhibitor SulA (Variovorax sp. SCN45)
MTIDTHLLALQLMAAQGLMGAFDTLYHHEGTEALAQRNTARRELSIHAVRSSIYCAIFIG
LSSWAWHGAWAWVLLAVFGVEIVLTLWDFVVEDGSRLLPPTERVTHTVLAINAGAFIALL
AMNAVDWAAQPTALVWQPQGWLGAFLALCGVGVGISGLRDGLAARALFRRTAQEEQRAAD
APVRFGGKPRHVLVTGGTGFIGQILVRHLLADGHAVTVWTRDARSAAWGFGGAVRCVQAL
EQIPATDDVDVVVNLAGARILGQRWSERRQRRLMQSRAGLTDTLVAWIAARPRKPWLLLS
GSAIGYYGVQPQGDIAELTEDAPPQDIFMSTLCQAWEQAARGALAHGVRVACMRFGFVLG
HQGSLPQLLLPVALGMGGRLGSGRQWLSWVHVHDVIRAMAHVWRLAEQAGGDAEAAQVFN
FTAPGALTQEEFTRVAASVMHRPCWMPTPAAPVRLLLGEQADLLLEGQRVVPARLLQTGF
QFAFPDARSALTDLCRPR