Protein Info for GFF5536 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details PF00892: EamA" amino acids 23 to 155 (133 residues), 66 bits, see alignment E=2.2e-22 amino acids 172 to 302 (131 residues), 63.1 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: None (inferred from 54% identity to dac:Daci_3915)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF5536 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNSTASLSSSLGPHHHAAAHERAGMWLMVAGGLMLGTLGIFLEEAGQSPLTAVWFRCAFG
LLALTAWFAVTRRWKELRLTGAARLAAVSAGVLAVINWVLFFEAIERTSIGVATVVVHVQ
PFLVMAFGALWWKERITRVQAAATLACLVGLALASGWVDGALTGAGWSPTYLWGIGLALF
NSVGYAALTLIANRARGVTPLALAWWQCAVGAVVLVWWPFVHGWPPAGPAWAWLAGLGAI
HTGLAYVVLYAGVARLSAGRVAVLQFVYPASAVAVEWAVYGRALSTSQLVGVLMMMVALV
VVGTQRAARQA