Protein Info for PS417_28330 in Pseudomonas simiae WCS417

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00132: Hexapep" amino acids 11 to 44 (34 residues), 30.6 bits, see alignment 2e-11 amino acids 79 to 111 (33 residues), 29.6 bits, see alignment 4e-11 PF14602: Hexapep_2" amino acids 96 to 129 (34 residues), 21.5 bits, see alignment 1.5e-08

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU6093)

Predicted SEED Role

"Carbonic anhydrase, gamma class (EC 4.2.1.1)" (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UND4 at UniProt or InterPro

Protein Sequence (186 amino acids)

>PS417_28330 carbonate dehydratase (Pseudomonas simiae WCS417)
MIRKNPSGDLPVIAESAYVDKTAIICGKVIIGENVFVGPYAVIRADEVDASGGMDPIVIG
ANSNIQDGVVIHSKSGAAVTIGEFTSIAHRSIVHGPCTVGDRVFIGFNSVLFNCAVGDGC
VVRHNSVVDGRDLPAAFYVPSTTRIGPHTDLSQFPPVSVSASEFSEDVARTNVDLVRGYK
ALQNEF