Protein Info for GFF5534 in Variovorax sp. SCN45

Annotation: Queuine tRNA-ribosyltransferase (EC 2.4.2.29)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR00449: tRNA-guanine family transglycosylase" amino acids 5 to 384 (380 residues), 469.9 bits, see alignment E=5e-145 TIGR00430: tRNA-guanine transglycosylase" amino acids 13 to 384 (372 residues), 498 bits, see alignment E=1.5e-153 PF01702: TGT" amino acids 15 to 386 (372 residues), 518.6 bits, see alignment E=4.2e-160

Best Hits

Swiss-Prot: 87% identical to TGT_DELAS: Queuine tRNA-ribosyltransferase (tgt) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 97% identity to vpe:Varpa_5790)

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF5534 Queuine tRNA-ribosyltransferase (EC 2.4.2.29) (Variovorax sp. SCN45)
MLNFELLKTDPGSHARRATLTLNHGKVQTPIFMPVGTYGTVKGVMPRSLEEMGAQIILGN
TFHLWMRPGLDVMASFGGLHQFEKWDKPILTDSGGFQVWSLGAMRKISEEGVKFASPVNG
DKLFLTPEVSMQIQTILNSDIVMQFDECTPYDTKGHITTEAEARISMELSLRWAKRCQAE
FNRLENPNALFGIVQGGMFENLREESLAALVDMDFPGYAIGGVSVGEPKEEMLHIMGHTP
HRLPANKPRYLMGVGTPEDLVQGVADGVDMFDCVMPTRNARNGTLFTRFGDLKMRNARHK
SDPQPIDPSCTCHACAGTSGVSWNDGGREGFSRAYLHHLDRCGEMLGPMLTTIHNLHYYL
NLMNEIRESLDAGTFTEFRARFKAERARGV