Protein Info for GFF5532 in Variovorax sp. SCN45

Annotation: Putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 21 to 207 (187 residues), 158.9 bits, see alignment E=1.7e-50 PF08659: KR" amino acids 21 to 181 (161 residues), 35 bits, see alignment E=2.1e-12 PF13561: adh_short_C2" amino acids 28 to 260 (233 residues), 193.1 bits, see alignment E=9.1e-61

Best Hits

Swiss-Prot: 50% identical to SQD_PSEPU: Sulfoquinovose 1-dehydrogenase (PpSQ1_00405) from Pseudomonas putida

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_5073)

Predicted SEED Role

"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF5532 Putative oxidoreductase (Variovorax sp. SCN45)
MTDASQLSPYTARYPSLAGRTVFISGGASGIGESLVRSFHAQGAKVGFCDLDTAAGSALA
AQLQGEHPALFVPCDVTDTAALAAAIDAVRQRFGPISVLLNNAANDRRHEMADVTSDDFD
RLVAVNFKHQFFAAQAVADDMRALGGGSIVNFGSISWMIKGKGYPVYQACKAAARGLTRS
LARDLGKQNIRVNSIVPGWVMTERQIKLWVKPESGAEIDAAQCLPGRVMAEDIAAMALFL
AADDSRMCTAQDYVVDAGWT