Protein Info for GFF5532 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG001454: Transglutaminase-like enzymes, putative cysteine proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 17 to 47 (31 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 559 to 580 (22 residues), see Phobius details PF11992: TgpA_N" amino acids 19 to 334 (316 residues), 230.1 bits, see alignment E=3.6e-72 PF01841: Transglut_core" amino acids 393 to 482 (90 residues), 79.4 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: None (inferred from 63% identity to vap:Vapar_3379)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>GFF5532 FIG001454: Transglutaminase-like enzymes, putative cysteine proteases (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLNKTLAALPRETRDTLFLLAVVGWVVVMQVAHIPWWCSALTATVLVWRGTLALRGLPLP
GWPWRLGLLAVTLVATWATHRTLLGQDAGVTLVVVLLALKTLEMRARRDAFVVFFLAFFT
LLTHFFYSQSLLTAAGILIALLGLLTALVNAHMPVGRPSLAQAARTAAGMAALGAPIMLV
LFLLFPRLSPLWGVPADDRGHSGLSGTMRVGQIAELALDDSIALRLRFEGDPPPASQLYF
RGPVLSAFDGVEWRPGRAEFPSRQALPSELTVSGAPIRYEVTMEPHRRPWLFLLEAAPQA
PELPDVRVHMTSELQWLTDRPMSSLVRFSAVSHTRFRHGPLAHTPALQELVALPPAYNPR
TLELARQLRREHGTGLGATPRLVEAVLERLRTGGYVYTLEPGLYGQHTADEFWFDRRQGF
CEHIASSFAVLMRALGIPARIVTGYQGGEMNNVDGYWTVRQRDAHAWTEVWHAGQGWVRV
DPTAAVAPGRVGSLQRLNAPEGAFAGAIRNLNPDIAAQLRAAWEAMNNSWNQWVLNYTQG
SQLDLLKNLGFRSPSWTDLAYVLIGVVVLVSLIGAAWTLWERQQHDPWLRLLHRARARLQ
AQGLSSSDRTPPRELAHRVQQHWGGSDAARRVAQWLLQLEAQRYARPGAADTPTLAALQR
EFRQLAWPRKDTR