Protein Info for PS417_28305 in Pseudomonas simiae WCS417
Annotation: GTP cyclohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to GCH4_PSEFS: GTP cyclohydrolase FolE2 (folE2) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K09007, hypothetical protein (inferred from 94% identity to pfs:PFLU6088)Predicted SEED Role
"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)
MetaCyc Pathways
- superpathway of chorismate metabolism (44/59 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
- erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
- threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
- preQ0 biosynthesis (2/4 steps found)
- tetrahydromonapterin biosynthesis (2/4 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.4.16
Use Curated BLAST to search for 3.5.4.16
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UR12 at UniProt or InterPro
Protein Sequence (298 amino acids)
>PS417_28305 GTP cyclohydrolase (Pseudomonas simiae WCS417) MNALTLPDIAAQASRQALPLDWVGMCGIALPILIDGQRLTATADAGVSLDDGAARGIHMS RLYLALEMLDQQPLTPALLRNVLQRFLDSHEGLSNNAYLRIHTDLLLKRPALVSPLAGWK GYPVSIEARLENQMFHVELKIDVTYSSTCPCSAALARQLIQQQFLEDFANTPLQHEDVLS WLGSANGIVATPHSQRSSAQLLIALDSEHPSLPITELIDNVEAALGTAVQTAVKREDEQA FALANGQNLMFCEDAARRLNLALKRSDAVKAFHLKVIHAESLHAHDAVAESRWTRHPA