Protein Info for GFF5527 in Variovorax sp. SCN45

Annotation: Asl0046 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details PF05360: YiaAB" amino acids 18 to 70 (53 residues), 56.8 bits, see alignment E=1.1e-19 amino acids 87 to 139 (53 residues), 56.4 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_5797)

Predicted SEED Role

"Asl0046 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>GFF5527 Asl0046 protein (Variovorax sp. SCN45)
MQPLSSTTVSIQRDTRAWQFQTWASFAIAVFLCATGLSWLPGQALDRAFMVMGYVFCLST
AFMLAKFIRDGEQAAAGLSTGRDVPMWRMVVWGSFFTAMALTGWGLVRMEINDTYKAFLG
VSWLFLISSAFTLAKTLRDRHEADMAEARLQGRRLARAEAAASSSTSASAE