Protein Info for GFF5527 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Potassium efflux system KefA protein / Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details PF21088: MS_channel_1st" amino acids 215 to 255 (41 residues), 29 bits, see alignment 1.3e-10 PF00924: MS_channel_2nd" amino acids 257 to 322 (66 residues), 59.8 bits, see alignment E=3.3e-20 PF21082: MS_channel_3rd" amino acids 333 to 415 (83 residues), 50.1 bits, see alignment E=4.6e-17

Best Hits

KEGG orthology group: None (inferred from 61% identity to pol:Bpro_3144)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>GFF5527 Potassium efflux system KefA protein / Small-conductance mechanosensitive channel (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNPSTNPKPIDDIGLWLAGFTQPTVLVELAALAVCVALAWGFSWALRNALRMQDDRSSVL
FGRRLIDGVMFPLALLTLGYIARALVTKFLPLAAFKVAIPVLVSLVVIRVGVKVLQAAFT
TAPWVRALERTISWVAWLAMVLWVSGLLPVVLAELDDITWKIGATTLSLRTLLEGSITAG
AVMILALWVSSAIESRLLRKATGGDLSMRKAVSNATRALLLFVGLIIALSAVGIDLTALS
VFSGAIGVGVGFGLQKLASNYVSGFVILAERRLRIGDNVKVDSFEGRILDINTRYSVIRS
PAGRESIVPNELMVINRVENLSTALTRVWQTSVVSVAYDSDVELVSQLLLAAVSEQEDAL
KEPAPQASLSAFGADGLQFTVGYWINSGDGAEQLRLLSRVNRRILQSLQEHAIEIPYPQR
VVRVKELPPLEGPKDSAVHQAG