Protein Info for GFF5522 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details PF05226: CHASE2" amino acids 41 to 328 (288 residues), 193.5 bits, see alignment E=1e-60 PF08448: PAS_4" amino acids 451 to 557 (107 residues), 32.1 bits, see alignment E=2.4e-11 PF00512: HisKA" amino acids 570 to 629 (60 residues), 28.3 bits, see alignment 2.9e-10 PF02518: HATPase_c" amino acids 675 to 782 (108 residues), 86.9 bits, see alignment E=2.6e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (788 amino acids)

>GFF5522 Signal transduction histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
LDTRPTESVTSQLQEPVARARRPRTRWLEWGLLSAALLAGVVALGCTRSLEHIDLALTDQ
LARLSHQTTSPEIVIVAIDDKSLTEIGRWPWRRAFHAALLDRITAAGPRAVGLDLIMVEP
EREQAVDDALLGDAIARNGKVVLPLMLLDNRGTGRLTRTDPAPELAQAAAAIGHVHLEID
SDGIVRSTFLREGDGERWWDQFAVALLRVGGSPLPDPLPGERAPPAQHPDAWQRDHWMQI
PFAGPPGTFPRVSYVDVLKGRVPPEQLAGKYVLVGSTAAGMGDAYATPRSGQAELMDGVE
IAANVMNTLLQNHRLERANAWQNALFCLVPVTLALLAVLLLTPTASLLASAALWIATLAA
AALAPALIGLQFAPTAALLGVLLAYPLWVWRRLRAALDYLLEEFQRMETRRDLPTMRPAA
RSGDLLDRHINALQDASQQLRNLHRFVSDTLNSVPDATLIADATGQVLAGNQAAYQYFGQ
QDVARLRGHPIGELLQGVHRTGTQQPVFDADRLRHATQPWGAEARDAAGRDLLVRFVPCF
NTDGQTNSWIASLVDITPIREAERQRDVALRFISHDMRSPQASILALLEVQRLTPGQPMQ
PETLGRIERHARRTLDLAEEFVQLARAESSTYRLETVDLVDLLDEAVDEVWPQAQAQRVN
LLVVRPEAPALCKADRSLLTRAIANLLGNAVKYGGEDAEVLCSVQAAEAGWRVSITDQGP
GMTPEQQERLFQQFARLEPEHRVSRGVGLGLVFVRTVIERHGARIEVLSQPGHGTTFHFT
IAAAESLP