Protein Info for PS417_28260 in Pseudomonas simiae WCS417

Annotation: VdlD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF03061: 4HBT" amino acids 23 to 97 (75 residues), 70.1 bits, see alignment E=8e-24

Best Hits

Swiss-Prot: 42% identical to Y654_CHLPN: Uncharacterized acyl-CoA thioester hydrolase CPn_0654/CP_0093/CPj0654/CpB0680 (CPn_0654) from Chlamydia pneumoniae

KEGG orthology group: K01076, [EC: 3.1.2.-] (inferred from 98% identity to pfo:Pfl01_5649)

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHG5 at UniProt or InterPro

Protein Sequence (158 amino acids)

>PS417_28260 VdlD (Pseudomonas simiae WCS417)
MEPGNAQLSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIF
REPIHVGELVTFLASVNYTGNTSMEVGIKVVTENIRERSVRHTNSCFFTMVAVDDQRKPA
PVPPLQPHNSEDKRRFVQAQQRRQIRQELEKRYQEIKG