Protein Info for PS417_28250 in Pseudomonas simiae WCS417

Annotation: cell wall assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF14567: SUKH_5" amino acids 1 to 133 (133 residues), 163.5 bits, see alignment E=2.6e-52 PF09346: SMI1_KNR4" amino acids 23 to 127 (105 residues), 39.6 bits, see alignment E=7.5e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a5599)

Predicted SEED Role

"FIG00956226: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBA7 at UniProt or InterPro

Protein Sequence (135 amino acids)

>PS417_28250 cell wall assembly protein (Pseudomonas simiae WCS417)
MEEIIEQLREANEPVPVPLELPDEDLLVEIEEQLFIDIPFVFREFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVDRSLIPICQDGDDYYCVEEDGTVVLWSGEEEIVTEET
WESVWHWARDVWLES