Protein Info for PS417_28245 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details PF04280: Tim44" amino acids 164 to 287 (124 residues), 36.5 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU6076)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJW9 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PS417_28245 membrane protein (Pseudomonas simiae WCS417)
MKRFLSIAMALCIGLTMSLDANAKRFGGGKSSGAAPTHQTSQMAPSAGATGGAAATAGAA
GAAGAAAKAGGASRWLGPLAGIAAGGLLASMFMGGGFQGMQIFDILILAVIAFVIFRFIA
ARRRKQQEHLAPAGAPMQREVFEQKPAMGSIFGGSAAPAAARPVINAPAWFNEERFVEAA
RSHFQSLQQHWDANEMDKISEFVTPQLLEFLKRERADLGDGFQSTYIDDLRVQLEGVDDR
ADKTIATLTFSGVSKTSRFDQGEVFSESWNMERAQGDNQPWLVAGIRQNG