Protein Info for GFF5518 in Variovorax sp. SCN45

Annotation: Nudix hydrolase family protein KPN_02621

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF27456: NudK_N" amino acids 6 to 44 (39 residues), 68.1 bits, see alignment 2.2e-23 TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family" amino acids 8 to 186 (179 residues), 142.2 bits, see alignment E=7.4e-46

Best Hits

Swiss-Prot: 56% identical to NUDK_PECAS: GDP-mannose pyrophosphatase NudK (nudK) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_5806)

MetaCyc: 56% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>GFF5518 Nudix hydrolase family protein KPN_02621 (Variovorax sp. SCN45)
MTLQDRVRVHEVTLLSDNWYTLRTTAFDWRRNDGQWQRMHRETYDRGNGATLLPYNLARR
TVLLVRQFRYPAFVNGHDDLLIEAAAGLLDNAAPEERIRAEVEEELGYRLGEVRKIFESF
MSPGSVTEKLHFFVAPYEPSMRVGAGGGLAEEGEDIEVLELDIDEALAMVADGRIADAKT
VMLLYHARLHLFAGPGL