Protein Info for GFF5512 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Two-component response regulator CreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details amino acids 27 to 28 (2 residues), see Phobius details transmembrane" amino acids 26 to 26 (1 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details PF00512: HisKA" amino acids 264 to 322 (59 residues), 52.7 bits, see alignment E=3.5e-18 PF02518: HATPase_c" amino acids 370 to 478 (109 residues), 86.8 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: K07641, two-component system, OmpR family, sensor histidine kinase CreC [EC: 2.7.13.3] (inferred from 55% identity to reh:H16_A0294)

Predicted SEED Role

"Two-component response regulator CreC"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>GFF5512 Two-component response regulator CreC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRIGLRLLIGFFLVLGLALFVVLRVLLDEVKPGTRLAMEDSLIDAAYTLAQLATPDMKAG
TIAEGFFARSLQGLDTARPGANIGGFRKDRIDYRITITDAEGIVRFDTRPEAIGQDHSRW
NDVVRTLRGEYGARSSPASPYDPDNTVMHVAAPIRDGDRVIGVLTVSRPNQRLQPYIDRS
EQRILRWSWALLGLSLLIGLLFSWWIASSLSRLRGYANAVSRGERAPLPVLGRLSGSTEF
ADLAGALERMRLKLEDKAYVESYVHTLTHELKSPLAAIRGAAELLQEDLPAPDRQRFAGN
VQRQAERLHLLVDKLLQLAHVEQMQGLGTREPVDLSALTRELLQRLEPRLHRKSLRVRDE
LGPGLVVHGDAFLIGQALQNLLDNAIDFSPPQGELWLRLHKEGGQVEWSVRDQGPGIPDY
ARDRLFERFYSLPRGEGQDKGSGLGLCLVKEVSDLHGGQVAVENVSSPGGCIARWRLPA