Protein Info for GFF5511 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Inner membrane protein CreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF06123: CreD" amino acids 6 to 435 (430 residues), 483.1 bits, see alignment E=4e-149

Best Hits

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>GFF5511 Inner membrane protein CreD (Hydrogenophaga sp. GW460-11-11-14-LB1)
LNKYPLLSKVLVIGLLMLLLSIPLMMVRDLVQERSQNRETATEEVARAHAGAQTLTGPVL
YVPYTETFTRTVSVGETGHTREERVTQSHAVIRFPTLMETRSELATETRWRGVFPITVYT
SVNRSTGRFVWSEVEPREKNGQISLGQPRLLMGVSDLRGLLNAPQLKIDGRPVAVAPAPA
AQRLPLPLAASLDLAQLKPGAVLPFELQLELAGTGRIGWVPLADENRVQLRSSWPHPSFD
GDFLPRTRSVSASGFEAAWSVPSLSTQAQQQFVQQGGEQRRTPESFSVSLGNPVDVYRLT
ERATKYGMMFIVLTFAAFFVLEMVKRWRIHPMQYLMIGAALVLFFLLLLSIAEHLDFVWA
YLVASAACIGLLAHYLRHVLGGWAPGLLMSGLLVALYGVLYGILISEDNALMMGSLLLFG
VLAAIMVATRKVDWYSVMGASTPSQDPPPQ