Protein Info for PS417_28195 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 69 to 163 (95 residues), 87.3 bits, see alignment E=4.1e-29 PF00528: BPD_transp_1" amino acids 88 to 267 (180 residues), 81.8 bits, see alignment E=2.6e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 87% identity to pfl:PFL_6154)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UB99 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PS417_28195 amino acid ABC transporter permease (Pseudomonas simiae WCS417)
MTAFPTPPKPPVNASRLQRLLGFRTRLYLTWAALFCLFASFFLSFDLKFSIILDKLPNLV
GLHLAPNGFLQGAALTVFLCLCAIVASSILGFVTALGRLSKSAVAFGIASFYASFFRGTP
LLIQILLIYLGLPQLGLVPGAIVAGIIALSLNYGAYLSEIFRAGILGVPHGQREAALALG
MRDSVIFWHVTLPQAMRTIIPPATNQFISMLKDSSLISVMGVWEVMFLAQSYGRSSYRYI
EMLTTAAIIYWVMSLGLELIQARMERHYGKGYVRRG