Protein Info for GFF5509 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Gluconate utilization system Gnt-I transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00356: LacI" amino acids 27 to 72 (46 residues), 48.8 bits, see alignment 9.4e-17 PF00532: Peripla_BP_1" amino acids 85 to 329 (245 residues), 94.3 bits, see alignment E=1.9e-30 PF13407: Peripla_BP_4" amino acids 88 to 275 (188 residues), 35.8 bits, see alignment E=1.3e-12 PF13377: Peripla_BP_3" amino acids 193 to 353 (161 residues), 106.6 bits, see alignment E=3e-34

Best Hits

Swiss-Prot: 36% identical to GNTR_ECOLI: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli (strain K12)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 72% identity to aav:Aave_2798)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>GFF5509 Gluconate utilization system Gnt-I transcriptional repressor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPFSRHSTPGKPLEPTERKRRHSGRTTLSDVARAAEVSPITASRALRGERSVAAELVERV
KLAAEQLGYVPDPAARALASQRSTQVPVLVPLLSNALFVDVLEAVHRTLLPHGYQTLIGV
THYEPREEEQLLRSYLAHRPAGLLLTGFDRTEAARQLIAGSGVPCVHLMELTQAPGVYCV
GFSQVEAGHAITEHLVQRGRRRIAFVAAQLDPRTMQRAEGYRRCLRQHGLYDAKLELLSP
QPSSMQLGGELLEDLLRTRPEVDAVFFCNDDLAQGGLLCALRLKIEVPARIAVAGFNDLS
GSDQMVPPLTTVRTPRRAIGEASAQMLLSLMRGEVPPKPSLDLGFEPLIRGSS