Protein Info for GFF5508 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Gluconokinase (EC 2.7.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01313: carbohydrate kinase, thermoresistant glucokinase family
  • amino acids 1 to 156 (156 residues), 160.8 bits, E=1.2e-51
• PF01202: SKI
  • amino acids 5 to 110 (106 residues), 31.4 bits, E=9.6e-12

Best Hits

Swiss-Prot: 41% identical to GCNK_GLUOX: Gluconokinase (GOX1709) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 60% identity to adk:Alide2_3014)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

• sorbitol biosynthesis II (3/3 steps found)
• D-gluconate degradation (1/1 steps found)
• L-idonate degradation (2/3 steps found)
• ketogluconate metabolism (5/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Protein Sequence (168 amino acids)

>GFF5508 Gluconokinase (EC 2.7.1.12) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MGVAGCGKSSLGQLCARTLGVPLLEGDDFHPASNVAKMRGGIALSDEDRAAWLDTLAEQL
QAHADGGVVLTCSALKLRYRDRLRAAMPGLRFVFLELTQEQARDRVAARPAHLFPVSLVA
SQFATLEDPRREPGVLPLDASRPLAELAAAVVHWVHGSATPHSLELRP