Protein Info for PS417_28175 in Pseudomonas simiae WCS417

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 23 to 134 (112 residues), 60.6 bits, E=2.6e-20
• PF13673: Acetyltransf_10
  • amino acids 34 to 135 (102 residues), 31.7 bits, E=2.1e-11
• PF13508: Acetyltransf_7
  • amino acids 55 to 134 (80 residues), 44 bits, E=3.6e-15

Best Hits

Swiss-Prot: 34% identical to HPA3_YEAST: D-amino-acid N-acetyltransferase HPA3 (HPA3) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU6066)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See U1UIM5 at UniProt or InterPro

Protein Sequence (148 amino acids)

>PS417_28175 GNAT family acetyltransferase (Pseudomonas simiae WCS417)
MSQIDIRPVTAADHAAWLPLWQAYLTFYNTELPDAVTQSTWQRLIDASEPTYSALAWQDG
KAVGMVNFIYHRSNWSIENSCYLQDLLVVPTERGTGVGRKLIEFVYATAKADGCCKVHWL
THETNATAIQLYERIAERPGFIQFRKGL