Protein Info for GFF5503 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details PF04143: Sulf_transp" amino acids 9 to 135 (127 residues), 35.9 bits, see alignment E=3.3e-13

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 66% identity to vap:Vapar_5568)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>GFF5503 Probable transmembrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHIDWTHFTPWTSLAGGILVGLAAAALILLNGRVLGVSGILGGLLPPRAGDAGWRIAFLL
GVFSAPLVFGWLAPDHLVRAPRIDAGDALLVVAGLLVGVGTRYGSGCTSGHGVCGLSRLS
PRSLVATLCFMAAGFLVVGVVRHLL