Protein Info for GFF550 in Variovorax sp. SCN45

Annotation: Cysteinyl-tRNA synthetase (EC 6.1.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 455 (453 residues), 547.7 bits, see alignment E=1.3e-168 PF01406: tRNA-synt_1e" amino acids 16 to 317 (302 residues), 434.8 bits, see alignment E=5.6e-134 PF00133: tRNA-synt_1" amino acids 252 to 308 (57 residues), 28.2 bits, see alignment 2.5e-10 PF09334: tRNA-synt_1g" amino acids 259 to 313 (55 residues), 29 bits, see alignment 1.5e-10 PF09190: DALR_2" amino acids 346 to 394 (49 residues), 53.7 bits, see alignment 7.4e-18 PF23493: CysS_C" amino acids 410 to 454 (45 residues), 25.8 bits, see alignment 2.8e-09

Best Hits

Swiss-Prot: 83% identical to SYC_POLNA: Cysteine--tRNA ligase (cysS) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 83% identity to pna:Pnap_2893)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>GFF550 Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Variovorax sp. SCN45)
MSLRIYNTLSRELEEFSPLQPGQVRMYVCGMTVYDFCHIGHARMMMAFDVVQRWLRASDY
AVAYVRNITDIDDKIIARSVQRGITIRELTDEVIAAMHEDIGALGIEPPTIEPRATEYVP
QMLGIIEKLEHKGLAYRSDNGDVNYAVRKFPGYGKLSGKSLDELHAGERVAVLDGKQDPL
DFVLWKAAKPTEPADAKWESAYGTGRPGWHIECSAMSCATLGETFDIHGGGADLQFPHHE
NEIAQSEGANGKPLSRFWVHNGFVRVDNEKMSKSLGNFFTIREVLQKYDAESLRFFLVRT
HYRSALNYSDAHLDDARNSLKRLYTALDLVAPADVSIDWTQPYAARFKAAMDEDFGTPEA
IAVLFELAGEVNRTKSAETAGLLKALAGSLGLLQGDPRSFLQAGSTLDDAAIQARIAERA
AAKAAKNFAEADRIRQELLEQGIVLKDSPTGTTWAAAQ