Protein Info for GFF550 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: C4-type zinc finger protein, DksA/TraR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR02420: RNA polymerase-binding protein DksA" amino acids 255 to 363 (109 residues), 142.5 bits, see alignment E=3.3e-46 PF21157: DksA_N" amino acids 259 to 329 (71 residues), 99.3 bits, see alignment E=1.2e-32 PF01258: zf-dskA_traR" amino acids 332 to 366 (35 residues), 42.8 bits, see alignment 4.1e-15

Best Hits

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>GFF550 C4-type zinc finger protein, DksA/TraR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKAPATRTAKSGKPAATGAKARASAAKKTTTVAKTQKPAAKPAAKPTRPIAKAAAKTAAK
KPLKTPVKTAAKPAPKAKAPAKPVVKAAVKVVAKGKVAVASKAPAPKATPAKTAARAPVK
AVKPVVKAAPKAAVPVTRPVSKAAPAAAVPAPKPSSAKRPAAPPPVVVEPTPRPLGKRAA
KKVMMEQMTQAAVVPTHAPDAAKATFSHMNQRAVMTPPVPSSIQKDPKRANNWKTLPVDQ
LTDLDVQAMPDSEYMSDLQLAYFRRKLSQLKADMLANAGETTEHLREDTVVVPDPADRAT
IEEEHALELRTRDRERKLLKKIEQAIARIDSGDYGYCEETGEPIGVGRLMARPTASLSLE
AQQRRELKQKMFGD